aminoacido

Páginas: 2 (487 palavras) Publicado: 15 de maio de 2014
Aminoácidos
Estrutura e Função

Aminoácidos
Estrutura
• Grupo carboxila e grupo
amino ligados à um mesmo
carbono;
• Diferem nas suas cadeias
laterais (grupo R);
• O grupo R é responsávelpelas propriedades do aa:
▫ Tamanho
▫ Carga elétrica
▫ Solubilidade

Aminoácidos

Classificação (Grupo R)

Grupo R alifático, Apolares
e hidrofóbico
• Cadeia lateral de alanina,valina, leucina, isoleucina,
agrupam-se dentro da
molécula .
• Glicina tem cadeia lateral
pequena (não participa das
interações hidrofóbicas).
• Metionina (precursor da
síntese protéica.

GrupoR Aromático
• Fenilalanina participa de
interações hidrofóbicas.
• Tirosina pode fazer pontes
de hidrogênio (-OH).
• Estes aa têm a capacidade
de absorver luz UV
(280nm) permitindo suaquantificação.
Fenilalanina hidroxilase Fenilcetonúria (PKU)

Grupo R não carregados e
polares
• Solúveis pela capacidade dos
grupos de formarem pontes de
hidrogênio com a água.
• Cisteínasformam pontes
dissulfeto (cistina)
contribuindo para a estrutura
3D das proteínas

Grupo R positivamente
carregados (básicos) e
hidrofílicos

Grupo R negativamente
carregados (ácidos) Não essenciais

Condicionalmente essenciais

Essenciais

Alanina

Arginina

Histidina

Asparagina

Glutamina

Isoleucina

Aspartato

Glicina

Leucina

Glutamato

ProlinaLisina

Serina

Tirosina

Metionina

Cisteína

Fenilalanina
Treonina
Triptofano
Valina

Modificações pós-traducionais de resíduos dentro da
proteína

Parede celular de plantas ecolágeno

Miosina
4 resíduos de lisina (elastina)

Protrombina no sangue

Muito raro

>sp|P0ABQ0|COABC_ECOLI Coenzyme A biosynthesis bifunctional
protein coaBC OS=Escherichia coli (strainK12)
MSLAGKKIVLGVSGGIAAYKTPELVRRLRDRGADVRVAMTEAAKAFITPLSLQAVSGYPV
SDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARVAAGMANDLVSTICLATPAPVAV
LPAMNQQMYRAAATQHNLEVLASRGLLIWGPDSGSQACGDIGPGRMLDPLTIVDMAVAHF...
Ler documento completo

Por favor, assinar para o acesso.

Estes textos também podem ser interessantes

  • Aminoácidos
  • Aminoacido
  • Aminoácidos
  • aminoácidos
  • aminoácidos
  • Aminoacidos
  • Aminoacidos
  • Aminoacidos

Seja um membro do Trabalhos Feitos

CADASTRE-SE AGORA!